Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      PVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQE GAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSD YLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQV IKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFG VLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASPHVYQVMNHCW KEKPEDRPPFSRLLSQLAE
    • Molecular weight
      57 kDa including tags
    • Amino acids
      352 to 620
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 1.0 pmol/min/μg

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 58 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.4% Tris HCl, 0.58% Sodium chloride, 0.05% Tween, 0.05% DTT, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • EMT
    • Homolog of mouse T cell itk/tsk
    • IL 2 inducible T cell kinase
    • IL2 inducible T cell kinase
    • Interleukin 2 inducible T cell kinase
    • Itk
    • ITK_HUMAN
    • Kinase EMT
    • LPFS1
    • LYK
    • MGC126257
    • MGC126258
    • PSCTK 2
    • PSCTK2
    • T cell specific kinase
    • T-cell-specific kinase
    • TSK
    • Tyrosine protein kinase
    • Tyrosine protein kinase ITK/TSK
    • Tyrosine protein kinase Lyk
    • Tyrosine-protein kinase ITK/TSK
    • Tyrosine-protein kinase Lyk
    see all
  • Function
    Plays a role in T-cell proliferation and differentiation.
  • Tissue specificity
    T-cell lines and natural killer cell lines.
  • Involvement in disease
    Defects in ITK are the cause of lymphoproliferative syndrome EBV-associated autosomal type 1 (LPSA1) [MIM:613011]. LPSA1 is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Inadequate immune response to EBV can have a fatal outcome. Clinical features include splenomegaly, lymphadenopathy, anemia, thrombocytopenia, pancytopenia, recurrent infections. There is an increased risk for lymphoma.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
    Contains 1 Btk-type zinc finger.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Cellular localization
    Cell membrane. Localizes to cell surface receptors in the plasma membrane after stimulation with respective receptors (TCR, CD28, CD2) in T-cells.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab196125 with Coomassie staining.

    Lane 1: 20 µg Active rat ITK protein fragment (ab196125)
    Lane 2: Protein marker

  • Enzyme reaction was conducted at 30°C for 1 hour with 2 μM Tyr peptide in 50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgCl2, 1 mM EGTA. After the 1 hour incubation, diluted development reagent was added. Percentage phosphorylation was calculated based on the emission ratio of 445/520 nm after excitation.

References

ab196125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up