Recombinant rat PAI1 protein (Biotin) (ab170081)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      SPLPESHTAQQATNFGVKVFQHVVQASKDRNVVFSPYGVSSVLAMLQLTT AGKTRQQIQDAMGFNISERGTAPALRKLSKELMGSWNKNEISTADAIFVQ RDLELVQGFMPHFFKLFRTTVKQVDFSEVERARFIINDWVERHTKGMISD LLAKGAVNELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSDGSTISVP MMAQNNKFNYTEFTTPDGHEYDILELPYHGETLSMFIAAPFEKDVPLSAI TNILDAELIRQWKSNMTRLPRLLILPKFSLETEVDLRGPLEKLGMTDIFS STQADFTSLSDQEQLSVAQALQKVKIEVNESGTVASSSTAILVSARMAPT EMVLDRSFLFVVRHNPTETILFMGQLMEP
    • Molecular weight
      43 kDa
    • Amino acids
      24 to 402
  • Conjugation
    Biotin

Specifications

Our Abpromise guarantee covers the use of ab170081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab170081 typically contains 50 percent active PAI1.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.00
    Constituents: 0.41% Sodium acetate, 0.03% EDTA, 2.34% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Clade E
    • Endothelial plasminogen activator inhibitor
    • Nexin
    • PAI
    • PAI 1
    • PAI-1
    • PAI1_HUMAN
    • PLANH1
    • Plasminogen activator inhibitor 1
    • Plasminogen activator inhibitor type 1
    • Serine (or cysteine) proteinase inhibitor
    • Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serpin E1
    • Serpin peptidase inhibitor clade E
    • Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serpine 1
    • SERPINE1
    see all
  • Function
    This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
  • Tissue specificity
    Found in plasma and platelets and in endothelial, hepatoma and fibrosarcoma cells.
  • Involvement in disease
    Defects in SERPINE1 are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1D) [MIM:613329]. It is a hematologic disorder characterized by increased bleeding after trauma, injury, or surgery. Affected females have menorrhagia. The bleeding defect is due to increased fibrinolysis of fibrin blood clots due to deficiency of plasminogen activator inhibitor-1, which inhibits tissue and urinary activators of plasminogen.
    Note=High concentrations of SERPINE1 seem to contribute to the development of venous but not arterial occlusions.
  • Sequence similarities
    Belongs to the serpin family.
  • Post-translational
    modifications
    Inactivated by proteolytic attack of the urokinase-type (u-PA) and the tissue-type (TPA), cleaving the 369-Arg-
    -Met-370 bond.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab170081.

    Lane 1: 3µg ab170081 Reduced
    Lane 2: Rat PAI1 (3µg) + Urokinase (15µg) Reduced
    Lane 3: Molecular weight markers

  • Avidin-Alkaline Phosphatase Western Blot analysis of ab170081.

    Lane 1: 0.1µg ab170081 Reduced
    Lane 2: Rat PAI1 (3µg) + Urokinase (2µg) Reduced

References

ab170081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up