Recombinant rat Prolactin Receptor protein (ab185247)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYE CPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYI VEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKP EEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSV EMPNDFTLKDTTVWIIVAILSAVICLIMVWAVALKGYSMMTCIFPPVPGP KIKGFDTHLLEKGKSEELLSALGCQDFPPTSDCEDLLVEFLEVDDNEDER LMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLLSEKCEEPQAYPPTL HIPEITEKPENPEANIPPTVDPQSTNPNFHVDAPKSSTWPLLPGQHMPRS PYHSVADVCKLAGSPVNTLDSFLDKAEENVLKLSKALETGEEEVAEQKGA KSFPSDKQNTPWPLLQEKSPTVYVKPPDYVEIHKVNKDGVLSLFPKQREN NQTEKPGVPETSKEYAKVSGITDNNILVLVPDSRAQNTALLEESAKKAPP SFEADQSEKDLASFTATSSNRRLQLGRLDYLDPTCFMHSFH
    • Molecular weight
      34 kDa
    • Amino acids
      20 to 229
    • Additional sequence information
      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab185247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.00004% Sodium bicarbonate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with water to 0.1 mg/ml

General Info

  • Alternative names
    • AI987712
    • CLONE SPM213
    • CPRLP
    • Delta 4-delta 7/11 truncated prolactin receptor
    • Delta 4-SF1b truncated prolactin receptor
    • HPRL
    • hPRL receptor
    • hPRLrI
    • Lactogen receptor
    • MFAB
    • MGC105486
    • OPR
    • OTTHUMP00000115998
    • Pr-1
    • Pr-3
    • PRL R
    • PRL-R
    • PRLR
    • Prlr-rs1
    • PRLR_HUMAN
    • Prolactin receptor
    • Prolactin receptor a
    • Prolactin receptor delta 7/11
    • RATPRLR
    • Secreted prolactin binding protein
    • Truncated testis-specific box 1-C prolactin receptor
    • wu:fj65c07
    see all
  • Function
    This is a receptor for the anterior pituitary hormone prolactin (PRL). Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.
  • Tissue specificity
    Expressed in breast, placenta, kidney, liver and pancreas.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Secreted and Membrane.
  • Information by UniProt

References

ab185247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up