Recombinant Rat SERPINA12 protein (ab191926)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      MNHKVHHHHHHMLQDRDAPDTYESPVRVQEWRGKKDARELTRHNMEFGFK LLQRLASNSRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMS DRDMHMGFHYLLQKLNRETQDVKMSIGNALFMDQRLRPQQRFLKLAKNLY DADMILTNFQDLENTQKNINKYISRKTHNRIENMVKNIDPGTVMLLTNYI YFQGRWQYEFDPKQTKEEDFFIEEGKTVKVPMMFQRGMYDMAYDSQLSCT ILEMPYRGNITATFVLPDSGKLRLLEQGLQADIFAKWKSLLSKRVVDVWV PRLHISATYNMKKVLSRLGISKIFEEHGDLTRISSHRSLKVGEAVHKAEL RMNEKGTEGAAGSGAQTLPMETPRRMKLNAPFLMMIYENLMPSMIFLARI YNP
    • Molecular weight
      47 kDa including tags
    • Amino acids
      21 to 411
    • Tags
      His tag N-Terminus
    • Additional sequence information
      This product is for the mature full length protein from aa 21 to 411. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.87% Sodium chloride

    0.2 µM filtered solution

General Info

  • Alternative names
    • ENSG00000165953
    • OL 64
    • OL-64
    • OL64
    • Serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 12
    • Serpin A12
    • Serpin A12 precursor
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 12
    • Serpina12
    • SPA12_HUMAN
    • Vaspin
    • Visceral adipose specific serpin
    • Visceral adipose tissue derived serine protease inhibitor
    • Visceral adipose tissue-derived serine protease inhibitor
    • Visceral adipose-specific serpin
    see all
  • Function
    May modulates insulin action conceivably only in the presence of its yet undefined target proteases in white adipose tissues.
  • Tissue specificity
    Expressed in visceral adipose tissues.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab191926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up