Recombinant rat VEGFC protein (ab52146)
Key features and details
- Expression system: Insect cells
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant rat VEGFC protein
See all VEGFC proteins and peptides -
Biological activity
This product is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT -4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR.
Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells (PAE/FLT -4 cells). The ED50 for this effect is typically 150-300 ng/ml. Inactive in the vascular permeability assay.
-
Purity
> 90 % SDS-PAGE.
Purity >90% by SDS-PAGE and visualised by silver stain.Product is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGFC by a Ser residue. Affinity purified. -
Expression system
Insect cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH -
Amino acids
101 to 221 -
Modifications
mutated C152S -
Tags
His tag C-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab52146 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Source: Insect cells. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Constituents: PBS, BSA
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitution: The lyophilised VEGFC is soluble in water and most aqueous buffers. The lyophilised VEGFC should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
General Info
-
Alternative names
- Flt 4L
- Flt4 ligand
- FLT4 ligand DHM
see all -
Function
Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. -
Tissue specificity
Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Post-translational
modificationsUndergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-227 and Ser-228 producing an heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions. -
Cellular localization
Secreted. - Information by UniProt
Images
-
In vivo: The lymphangiogenic response to recombinant rat VEGF-CC152S loaded in our biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats. Briefly, after ischemia-reperfusion injury to induce myocardial infarction, VEGF-CC152S at the dose of 1.5 or 5 µg per heart was injected intra-myocardially. Lymphatic responses in the myocardium were analyzed by IHC at 3 weeks post-MI using LYVE1 antibody (RT, #103-PA50). Results are expressed as lymphatic vessel to cardiomyocyte ratio (mean ± sem).
-
SDS-PAGE analysis of recombinant rat VEGF-C152 mutant. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Coomassie blue.
-
In vitro: The proliferative response to recombinant rat VEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells. Briefly, cells were plated in 12-well plates and incubated in DMEM medium supplemented with 1% fetal calf serum for cell cycle arrest 24h prior to stimulation of cell proliferation with recombinant VEGF-CC152S at the concentrations of 50 and 100 ng/mL. After 48h in culture, the cell proliferative response was assayed (WST-1 colorimetric assay), and the results expressed as % of control non-stimulated cells (mean ± sem).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab52146 has not yet been referenced specifically in any publications.