Recombinant Rhesus monkey SAA1 protein (ab110685)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP02738
    • SpeciesRhesus monkey
    • SequenceRSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPG GVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGL PEKY
    • Molecular weight12 kDa
    • Amino acids1 to 104

Specifications

Our Abpromise guarantee covers the use of ab110685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityDetermined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml
  • Applications

    SDS-PAGE

    HPLC

  • Purity> 97 % SDS-PAGE.
    ab110685 is purified by proprietary chromatographic techniques. Purity by HPLC is 97%.
  • FormLyophilised
  • Additional notes Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    pH: 7.40
    Constituent: PBS

  • ReconstitutionReconstitute in sterile ddH2O to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffers.

General Info

  • Alternative names
    • amyloid A, serum
    • Amyloid fibril protein AA
    • Amyloid protein A
    • MGC111216
    • PIG4
    • SAA
    • SAA2
    • Serum amyloid A protein
    • serum amyloid A-1 protein
    • serum amyloid A1
    • TP53I4
    • Tumor protein p53 inducible protein 4
    see all
  • RelevanceMajor acute phase reactant. Apolipoprotein of the HDL complex.
  • Cellular localizationSecreted

References for Recombinant Rhesus monkey SAA1 protein (ab110685)

ab110685 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab110685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"