Recombinant S. cerevisiae Smt3 protein (His tag) (ab225640)

Overview

  • Product name
    Recombinant S. cerevisiae Smt3 protein (His tag)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Saccharomyces cerevisiae
    • Sequence
      SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEA FAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
    • Molecular weight
      27 kDa including tags
    • Amino acids
      2 to 98
    • Tags
      His tag N-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 2 to 98 with a 6xHis-SUMO tag at the N-terminus. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names
    • DmSUMO 1
    • Small Ubiquitin-like modifier
    • SMT3
    • SMT3_YEAST
    • Ubiquitin like protein of the SUMO family
    • Ubiquitin like protein SMT3
    • Ubiquitin-like protein SMT3
    see all
  • Function
    Not known; suppressor of MIF2 mutations.
  • Sequence similarities
    Belongs to the ubiquitin family. SUMO subfamily.
    Contains 1 ubiquitin-like domain.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225640 with 5% enrichment gel and 15% separation gel.

References

ab225640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up