Recombinant S. cerevisiae TXNRD1 protein (ab82634)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP29509
    • SpeciesSaccharomyces cerevisiae
    • SequenceMVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTT EIENFPGFPD GLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFK LWTEFNEDAEPVTTDAIILATG ASAKRMHLPGEETYWQKGISACAVCD GAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKV FMLVRKDHLRASTI MQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLP VS GLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDS KYRQAITS AGSGCMAALDAEKYLTSLE
    • Molecular weight34 kDa
    • Amino acids1 to 319

Specifications

Our Abpromise guarantee covers the use of ab82634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity : 25.6 U/mg. One unit will cause the oxidation of 1µmole of NADPH per minute by deltaA412/0.0136 x 2.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Additional notes

    Yeast thioredoxin reductase is a flavoprotein with a molecular weight of approx. 35,000 and consist of two subunits, each containing one molecule of FAD and catayzes the NADPH-dependent reduction of thioredoxin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20mM HEPES, 1mM EDTA, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • cytoplasmic
    • Gene associated with retinoic and IFN-induced mortality 12 protein
    • Gene associated with retinoic and interferon-induced mortality 12 protein
    • Gene associated with retinoid IFN induced mortality 12 protein
    • GRIM 12
    • GRIM-12
    • GRIM12
    • KDRF
    • KM 102 derived reductase like factor
    • KM-102-derived reductase-like factor
    • MGC9145
    • Oxidoreductase
    • Thioredoxin reductase 1
    • Thioredoxin reductase 1 cytoplasmic
    • Thioredoxin reductase GRIM 12
    • Thioredoxin reductase TR1
    • TR
    • TR 1
    • TR1
    • TRXR 1
    • TRXR1
    • TRXR1_HUMAN
    • TXNR
    • TXNRD 1
    • Txnrd1
    see all
  • FunctionIsoform 1 may possess glutaredoxin activity as well as thioredoxin reductase activity and induces actin and tubulin polymerization, leading to formation of cell membrane protrusions. Isoform 4 enhances the transcriptional activity of estrogen receptors alpha and beta while isoform 5 enhances the transcriptional activity of the beta receptor only. Isoform 5 also mediates cell death induced by a combination of interferon-beta and retinoic acid.
  • Tissue specificityIsoform 1 is expressed predominantly in Leydig cells (at protein level). Also expressed in ovary, spleen, heart, liver, kidney and pancreas and in a number of cancer cell lines. Isoform 4 is widely expressed with highest levels in kidney, testis, uterus, ovary, prostate, placenta and fetal liver.
  • Sequence similaritiesBelongs to the class-I pyridine nucleotide-disulfide oxidoreductase family.
    Contains 1 glutaredoxin domain.
  • DomainThe N-terminal glutaredoxin domain found in isoform 1 does not contain the C-P-Y-C redox-active motif normally found in glutaredoxins and has been found to be inactive in classical glutaredoxin assays.
  • Post-translational
    modifications
    The N-terminus of isoform 5 is blocked.
    ISGylated.
  • Cellular localizationCytoplasm and Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant S. cerevisiae TXNRD1 protein images

  • ab82634 (1µg) on SDS-PAGE.

References for Recombinant S. cerevisiae TXNRD1 protein (ab82634)

ab82634 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"