Recombinant S. pyogenes htrA protein (His tag) (ab190416)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Streptococcus pyogenes
    • Sequence
      TQLTQKSSVNNSNNNSTITQTAYKNENSTTQAVNKVKDAVVSVITYSANR QNSVFGNDDTDTDSQRISSEGSGVIYKKNDKEAYIVTNNHVINGASKVDI RLSDGTKVPGEIVGADTFSDIAVVKISSEKVTTVAEFGDSSKLTVGET AIAIGSPLGSEYANTVTQGIVSSLNRNVSLKSEDGQAISTKAIQTDTAIN PGNSGGPLINIQGQVIGITSSKIATNGGTSVEGLGFAIPANDAINIIEQL EKNGKVTRPALGIQMVNLSNVSTSDIRRLNIPSNVTSGVVVRSVQSNMPA NGHLEKYDVITKVDDKEIASSTDLQSALYNHSIGDTIKITYYRNGKEETT SIKLNKSSGDLES
    • Molecular weight
      41 kDa including tags
    • Amino acids
      33 to 393
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab190416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 85 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.02% Imidazole
    Constituents: 0.79% Tris HCl, 1.74% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • htrA
    • Serine protease
    • Slr1204
  • Relevance
    htrA belongs to a serine type Deg peptidase family, widespread among bacteria and eukaryotes. This family includes three related members htrA (DegP), HhoA (DegQ) and HhoB (DegS). htrA is a highly hydrophilic protein and probably resides in a soluble compartment. The functions of htrA in cyanobacteria are not studied yet, however, in E. coli, htrA is a heat stress protein that functions in a homohexameric state in the periplasm.
  • Cellular localization
    Periplasm

Images

  • SDS-PAGE analysis of ab190416

References

ab190416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up