Recombinant Simian Virus 40 (SV40) SV40 Large T Antigen protein (ab82118)

Overview

  • Product name
    Recombinant Simian Virus 40 (SV40) SV40 Large T Antigen protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Simian Virus 40
    • Sequence
      MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEE KMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNE ENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAV FSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTP HRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPG GLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRV DSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPK MDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNV NLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDY LDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQARFVKQIDFRAK DYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNED GGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKK PPTPPPEPET
    • Amino acids
      1 to 708
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab82118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Other

  • Purity
    > 95 % Affinity purified.
    ab82118 is greater than 95% homogeneous based on SDS-PAGE analysis, purified by affinity and FPLC chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Potassium chloride, 1mM DTT, 0.2mM EDTA, pH 8.0

General Info

  • Alternative names
    • Large T antigen
    • LT
    • LTAG
    • Simian virus 40
  • Relevance
    SV40 T antigen is encoded by the early region of the SV40 genome. The large T antigen binds DNA, and complexes with a 53,000 dalton cellular protein, p53, which is required for initiation of viral DNA replication during lytic growth. In addition the large T antigen binds DNA polymerase and the transcription factor AP2 and forms a specific complex with the P105 product of the retinoblastoma susceptibility gene.
  • Cellular localization
    Host nucleus

References

ab82118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab82118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up