Recombinant Simian Virus 40 (SV40) SV40 Large T Antigen protein (ab82118)

Overview

  • Product name
    Recombinant Simian Virus 40 (SV40) SV40 Large T Antigen protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Simian Virus 40
    • Sequence
      MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEE KMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNE ENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAV FSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTP HRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPG GLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRV DSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPK MDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNV NLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDY LDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQARFVKQIDFRAK DYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNED GGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKK PPTPPPEPET
    • Amino acids
      1 to 708
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab82118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Other

  • Purity
    > 95 % Affinity purified.
    ab82118 is greater than 95% homogeneous based on SDS-PAGE analysis, purified by affinity and FPLC chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Potassium chloride, 1mM DTT, 0.2mM EDTA, pH 8.0

General Info

  • Alternative names
    • Large T antigen
    • LT
    • LTAG
    • Simian virus 40
  • Relevance
    SV40 T antigen is encoded by the early region of the SV40 genome. The large T antigen binds DNA, and complexes with a 53,000 dalton cellular protein, p53, which is required for initiation of viral DNA replication during lytic growth. In addition the large T antigen binds DNA polymerase and the transcription factor AP2 and forms a specific complex with the P105 product of the retinoblastoma susceptibility gene.
  • Cellular localization
    Host nucleus

References for Recombinant Simian Virus 40 (SV40) SV40 Large T Antigen protein (ab82118)

ab82118 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up