Overview

  • Product name
    Recombinant Soybean BBI protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Soybean
    • Sequence
      MDDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQC FCVDITDFCYEPCKPSEDDKENLEHHHHH
    • Molecular weight
      9 kDa including tags
    • Amino acids
      40 to 110
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 40 to 110. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab193076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • BBI
    • Bowman Birk proteinase inhibitor
    • Bowman-Birk type proteinase inhibitor
    • IBB1_SOYBN
  • Function
    Inhibitor of trypsin and of chymotrypsin.
  • Sequence similarities
    Belongs to the Bowman-Birk serine protease inhibitor family.
  • Developmental stage
    This protein is apparently expressed only in developing seeds.
  • Information by UniProt

References

ab193076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up