Recombinant Soybean p34 protein (ab73805)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO64458
    • SpeciesSoybean
    • SequenceMGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSE HGRVYHNHEE EAKRLEIFKNNLNYIRDMNANRKSPHSHRLGLNKFADI TPQEFSKKYLQAPKDVSQQIKM ANKKMKKEQYSCDHPPASWDWRKKGV ITQVKYQGGCGSGWAFSATGAIEAAHAIATGDLV SLSEQELVDCVEES EGCYNGWHYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVT ID GYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGEN CTSPYGIN HFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTG NLLGVCGMNYFASYPTKEES ETLVSARVKGHRRVDHSPL
    • Molecular weight43 kDa including tags
    • Amino acids1 to 379
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab73805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab73805 is purified by proprietary chromatographic technique. Purity is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

    Preservative: None
    Constituents: 50% Glycerol, 60mM Sodium chloride, 50mM Tris HCl, 10mM Glutathione, pH 8.0

General Info

  • Alternative names
    • 34 kDa maturing seed vacuolar thiol protease precursor
    • LOC548062
    • P34 probable thiol protease
  • Relevancep34 belongs to the peptidase C1 family and is probably a thiol protease.
  • Cellular localizationVacuole.

References for Recombinant Soybean p34 protein (ab73805)

ab73805 has not yet been referenced specifically in any publications.

Product Wall

ab73805 is a Soybean P34 full length protein. The protein is fused to a His tag at C-terminus. The molecular weight of this protein should be 43 kDa in theory however, we observe a molecular weight of 30kDa in our Hepes buffer system.


ab7...

Read More

Thank you for contacting Abcam about ab73805. The laboratory has informed that the E.Coli derived recombinant protein contains only the Soybean P34 protein epitopes 214-261, 351-379 amino acids. The protein is fused to a GST tag at N-terminus. If there...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"