Overview

  • Product nameRecombinant VP16 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SequenceSTAPPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPH DSAPYGALDMADFEFEQMFTDALGIDEYGG
    • Amino acids411 to 490

Specifications

Our Abpromise guarantee covers the use of ab81832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    Isolated from an E. coli strain that carries the coding sequence of the fused protein under the control of a T7 promoter.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Potassium chloride, 1mM DTT, 0.2mM EDTA, pH 8

General Info

  • Alternative names
    • Alpha TIF
    • Alpha trans inducing protein
    • ICP25
    • UL48
    • Vmw65
    • VP16 protein
    see all
  • RelevanceHerpes virus VP16 activates expression of immediate early genes in virally-infected cells. As most other eukaryotic transcriptional activator proteins, VP16 has a modular domain structure: it’s N-terminus is involved in DNA-protein interactions, while it’s C-terminal 79 amino acids have proven to be an especially potent transactivation domain. VP16 has been shown to bind to TBP, TFIIB, and replication factor A

References for Recombinant VP16 protein (ab81832)

ab81832 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"