Recombinant West Nile Virus preM protein (Tagged-His Tag) (ab187231)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence
      MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYLCEDTI TYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTH GESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
    • Molecular weight
      20 kDa including tags
    • Amino acids
      124 to 259

Specifications

Our Abpromise guarantee covers the use of ab187231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    ab187231 was purified by proprietary chromatographic technique.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 99% Phosphate Buffer

General Info

  • Alternative names
    • membrane glycoprotein M
    • membrane glycoprotein precursor prM
    • pre M protein
    • West Nile virus
  • Relevance
    West Nile Virus is part of the flavivirus family, many of which are capable of causing serious illness in humans. The ssRNA + strand virus is enveloped and spherical with a diameter of 40-50 nm, similar to all flaviviruses. The virion of this virus is a nucleocapsid covered by a lipoprotein envelope. The envelope contains two proteins: the protein M and glycoprotein E. The nucleocapsid is a complex of protein C and mRNA. In immature particles, there are 60 icosaedrally organized trimeric spikes on the surface. Each spike consists of three heterodimers of envelope protein M precursor (prM) and envelope protein E. Inside cells, viral particles will contain a preM particle and E in a complex that matures through proteolytic cleavage and processing in the Golgi apparatus. WNV has three different effects on humans, the first is asymptomatic infection; the second is a mild febrile syndrome termed West Nile Fever; the third is a neuroinvasive disease termed West Nile meningitis or encephalitis. In infected individuals the ratio between the three states is roughly 110:30:1. The main route of human infection is through the bite of an infected mosquito.

References

ab187231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up