Overview

  • Product name
  • Description
    Rabbit polyclonal to RECQL5
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Dog, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 450 - 500 (

    SSSWSKTCIGPSQGNGFDPELYEGGRKGYGDFSRYDEGSGGSGDEGRDEA H

    ) of Human RECQL5 (NP_004250.4).

  • Positive control
    • HeLa cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: Tris citrate/phosphate, pH 7 - 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab91419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
IP
  • Application notes
    IP: Use at 5-15µg/mg of lysate.
    WB: 1/2000 - 1/10000. Predicted molecular weight: 109 kDa.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Function
      May have an important role in DNA metabolism.
    • Tissue specificity
      Ubiquitous.
    • Sequence similarities
      Belongs to the helicase family. RecQ subfamily.
      Contains 1 helicase ATP-binding domain.
      Contains 1 helicase C-terminal domain.
    • Cellular localization
      Cytoplasm and Nucleus > nucleoplasm.
    • Information by UniProt
    • Database links
    • Alternative names
      • ATP-dependent DNA helicase Q5 antibody
      • DNA helicase antibody
      • DNA helicase, RecQ like type 5 antibody
      • DNA helicase, RECQ-like, type 5 antibody
      • EC 3.6.1.- antibody
      • FLJ90603 antibody
      • RecQ helicase protein-like 5 beta antibody
      • RecQ protein-like 5 antibody
      • RecQ protein-like 5, isoform CRA_b antibody
      • RecQ-like type 5 antibody
      • RecQ5 antibody
      • RECQ5_HUMAN antibody
      • Recq5b antibody
      • RECQL5 antibody
      • Recql5b antibody
      see all

    Images

    • All lanes : Anti-RECQL5 antibody (ab91419) at 0.1 µg/ml

      Lane 1 : HeLa cell lysate at 50 µg
      Lane 2 : HeLa cell lysate at 15 µg
      Lane 3 : HeLa cell lysate at 5 µg

      Developed using the ECL technique

      Predicted band size : 109 kDa


      Exposure time : 3 minutes
    • SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91419.
      20% of the immunoprecipitate was loaded per lane, and probed with ab91419 at 1µg/ml (lane 1) or a control IgG (lane2).
      Detection: chemoluminescence with an exposure time of 10 seconds.

    References

    ab91419 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab91419.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up