Overview

  • Product name
  • Description
    Rabbit polyclonal to RECQL5
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Dog, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 450 - 500 (

    SSSWSKTCIGPSQGNGFDPELYEGGRKGYGDFSRYDEGSGGSGDEGRDEA H

    ) of Human RECQL5 (NP_004250.4).

  • Positive control
    • HeLa cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: Tris citrate/phosphate, pH 7 - 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab91419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
IP
  • Application notes
    IP: Use at 5-15µg/mg of lysate.
    WB: 1/2000 - 1/10000. Predicted molecular weight: 109 kDa.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Function
      May have an important role in DNA metabolism.
    • Tissue specificity
      Ubiquitous.
    • Sequence similarities
      Belongs to the helicase family. RecQ subfamily.
      Contains 1 helicase ATP-binding domain.
      Contains 1 helicase C-terminal domain.
    • Cellular localization
      Cytoplasm and Nucleus > nucleoplasm.
    • Information by UniProt
    • Database links
    • Alternative names
      • ATP-dependent DNA helicase Q5 antibody
      • DNA helicase antibody
      • DNA helicase, RecQ like type 5 antibody
      • DNA helicase, RECQ-like, type 5 antibody
      • EC 3.6.1.- antibody
      • FLJ90603 antibody
      • RecQ helicase protein-like 5 beta antibody
      • RecQ protein-like 5 antibody
      • RecQ protein-like 5, isoform CRA_b antibody
      • RecQ-like type 5 antibody
      • RecQ5 antibody
      • RECQ5_HUMAN antibody
      • Recq5b antibody
      • RECQL5 antibody
      • Recql5b antibody
      see all

    Anti-RECQL5 antibody images

    • All lanes : Anti-RECQL5 antibody (ab91419) at 0.1 µg/ml

      Lane 1 : HeLa cell lysate at 50 µg
      Lane 2 : HeLa cell lysate at 15 µg
      Lane 3 : HeLa cell lysate at 5 µg

      Developed using the ECL technique

      Predicted band size : 109 kDa


      Exposure time : 3 minutes
    • SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91419.
      20% of the immunoprecipitate was loaded per lane, and probed with ab91419 at 1µg/ml (lane 1) or a control IgG (lane2).
      Detection: chemoluminescence with an exposure time of 10 seconds.

    References for Anti-RECQL5 antibody (ab91419)

    ab91419 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab91419.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up