
  • Product nameAnti-RECQL5 antibody
    See all RECQL5 primary antibodies
  • Description
    Rabbit polyclonal to RECQL5
  • Tested applicationsSuitable for: IHC-P, WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 (MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVF V) of Human RECQL5 (NP_004250.4).

  • Positive control
    • HeLa cell lysate



Our Abpromise guarantee covers the use of ab91422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/2000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/2000 - 1/10000. Predicted molecular weight: 109 kDa.
IP Use at 5-15 µg/mg of lysate.


  • FunctionMay have an important role in DNA metabolism.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the helicase family. RecQ subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localizationCytoplasm and Nucleus > nucleoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP-dependent DNA helicase Q5 antibody
    • DNA helicase antibody
    • DNA helicase, RecQ like type 5 antibody
    • DNA helicase, RECQ-like, type 5 antibody
    • EC 3.6.1.- antibody
    • FLJ90603 antibody
    • RecQ helicase protein-like 5 beta antibody
    • RecQ protein-like 5 antibody
    • RecQ protein-like 5, isoform CRA_b antibody
    • RecQ-like type 5 antibody
    • RecQ5 antibody
    • RECQ5_HUMAN antibody
    • Recq5b antibody
    • RECQL5 antibody
    • Recql5b antibody
    see all

Anti-RECQL5 antibody images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast carcinoma tissue labelling RECQL5 with ab91422 at 1/1000 (1µg/ml). Detection: DAB.
  • All lanes : Anti-RECQL5 antibody (ab91422) at 0.1 µg/ml

    Lane 1 : HeLa cell lysate at 50 µg
    Lane 2 : HeLa cell lysate at 15 µg
    Lane 3 : HeLa cell lysate at 5 µg

    Predicted band size : 109 kDa
  • SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91422.
    20% of the immunoprecipitate was loaded per lane, and probed with ab91422 at 1µg/ml (lane 1) or a control IgG (lane2).
    Detection: chemoluminescence with an exposure time of 10 seconds.

References for Anti-RECQL5 antibody (ab91422)

This product has been referenced in:
  • Patterson K  et al. Altered RECQL5 expression in urothelial bladder carcinoma increases cellular proliferation and makes RECQL5 helicase activity a novel target for chemotherapy. Oncotarget 7:76140-76150 (2016). WB ; Human . Read more (PubMed: 27764811) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab91422.
Please use the links above to contact us or submit feedback about this product.