
  • Product name
  • Description
    Rabbit polyclonal to RECQL5
  • Tested applications
    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 (MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVF V) of Human RECQL5 (NP_004250.4).

  • Positive control
    • HeLa cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: Tris citrate/phosphate, pH 7.0-8.0
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab91422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/2000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/2000 - 1/10000. Predicted molecular weight: 109 kDa.
IP Use at 5-15 µg/mg of lysate.


  • Function
    May have an important role in DNA metabolism.
  • Tissue specificity
  • Sequence similarities
    Belongs to the helicase family. RecQ subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Cytoplasm and Nucleus > nucleoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP-dependent DNA helicase Q5 antibody
    • DNA helicase antibody
    • DNA helicase, RecQ like type 5 antibody
    • DNA helicase, RECQ-like, type 5 antibody
    • EC 3.6.1.- antibody
    • FLJ90603 antibody
    • RecQ helicase protein-like 5 beta antibody
    • RecQ protein-like 5 antibody
    • RecQ protein-like 5, isoform CRA_b antibody
    • RecQ-like type 5 antibody
    • RecQ5 antibody
    • RECQ5_HUMAN antibody
    • Recq5b antibody
    • RECQL5 antibody
    • Recql5b antibody
    see all

Anti-RECQL5 antibody images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast carcinoma tissue labelling RECQL5 with ab91422 at 1/1000 (1µg/ml). Detection: DAB.
  • All lanes : Anti-RECQL5 antibody (ab91422) at 0.1 µg/ml

    Lane 1 : HeLa cell lysate at 50 µg
    Lane 2 : HeLa cell lysate at 15 µg
    Lane 3 : HeLa cell lysate at 5 µg

    Predicted band size : 109 kDa
  • SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91422.
    20% of the immunoprecipitate was loaded per lane, and probed with ab91422 at 1µg/ml (lane 1) or a control IgG (lane2).
    Detection: chemoluminescence with an exposure time of 10 seconds.

References for Anti-RECQL5 antibody (ab91422)

This product has been referenced in:
  • Patterson K  et al. Altered RECQL5 expression in urothelial bladder carcinoma increases cellular proliferation and makes RECQL5 helicase activity a novel target for chemotherapy. Oncotarget 7:76140-76150 (2016). WB ; Human . Read more (PubMed: 27764811) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab91422.
Please use the links above to contact us or submit feedback about this product.


Sign up