Anti-Repulsive Guidance Molecule C antibody (ab102029)

Overview

  • Product nameAnti-Repulsive Guidance Molecule C antibody
    See all Repulsive Guidance Molecule C primary antibodies
  • Description
    Rabbit polyclonal to Repulsive Guidance Molecule C
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA

    ) of Human Repulsive Guidance Molecule C (NP_973733).

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab102029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceMutations in Repulsive Guidance Molecule (also known as RGM-C; HJV; hemojuvelin; Hfe2) cause juvenile hemochromatosis, a severe iron overload disease. RGM-C gene expression has been characterized in the developing mouse and found to be exclusively expressed in all striated muscle and in the myocardium.
  • Cellular localizationCell membrane; Lipid-anchor, GPI-anchor
  • Database links
  • Alternative names
    • 2310035L15Rik antibody
    • 5230400G09Rik antibody
    • AI414844 antibody
    • AI789733 antibody
    • DL M antibody
    • Haemojuvelin antibody
    • HEMOCHROMATOSIS antibody
    • HEMOCHROMATOSIS DUE TO DEFECT IN HEMOJUVELIN antibody
    • HEMOCHROMATOSIS DUE TO DEFECT IN HEPCIDIN ANTIMICROBIAL PEPTIDE antibody
    • HEMOCHROMATOSIS JUVENILE antibody
    • Hemochromatosis type 2 (juvenile) antibody
    • Hemochromatosis type 2 antibody
    • Hemochromatosis type 2 protein antibody
    • Hemochromatosis type 2 protein homolog antibody
    • HEMOCHROMATOSIS, TYPE 2A antibody
    • HEMOCHROMATOSIS, TYPE 2B antibody
    • Hemojuvelin antibody
    • HFE 2 antibody
    • Hfe2 antibody
    • HFE2A antibody
    • HJV antibody
    • JH antibody
    • Juvenile antibody
    • MGC23953 antibody
    • OTTHUMP00000059680 antibody
    • Repulsive guidance molecule c antibody
    • RGM C antibody
    • RGM domain family member C antibody
    • RGMC antibody
    see all

Anti-Repulsive Guidance Molecule C antibody images

  • Anti-Repulsive Guidance Molecule C antibody (ab102029) at 1 µg/ml + HT1080 Cell Lysate at 10 µg

    Predicted band size : 45 kDa

References for Anti-Repulsive Guidance Molecule C antibody (ab102029)

ab102029 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"