Overview

  • Product name
    Anti-REXO2 antibody [AT59D9]
    See all REXO2 primary antibodies
  • Description
    Mouse monoclonal [AT59D9] to REXO2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human REXO2 aa 26-237. Purified from E. coli. (NCBI Accession No.: NP_056338)
    Sequence:

    VREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNIL AEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFL SFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKEL CRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRK IIENGENEKTVS


    Database link: Q9Y3B8

  • Positive control
    • SW480 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    AT59D9
  • Isotype
    IgG2b
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 27 kDa.

Target

Images

  • Anti-REXO2 antibody [AT59D9] (ab177527) at 1/500 dilution + SW480 cell lysate at 40 µg

    Secondary
    Goat anti-mouse secondary conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 27 kDa

References

ab177527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up