Overview

  • Product name
  • Description
    Rabbit polyclonal to RFC1
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Chicken, Human, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human RFC1 aa 101-340.
    Sequence:

    QDPVTYISETDEEDDFMCKKAASKSKENGRSTNSHLGTSNMKKNEENTKT KNKPLSPIKLTPTSVLDYFGTGSVQRSNKKMVASKRKELSQNTDESGLND EAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKKARKDTEAGET FSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKR


    Database link: P35251

  • Positive control
    • U2OS cells transfected with Flag-RFC1; U2OS, NIH3T3, DT40 and INS1 cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/2000.
WB 1/2000. Predicted molecular weight: 128 kDa.

Target

  • Function
    The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA.
    Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair.
  • Tissue specificity
    Wide tissue distribution. Undetectable in placental tissue.
  • Sequence similarities
    Belongs to the activator 1 large subunit family.
    Contains 1 BRCT domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • A1 140 kDa subunit antibody
    • A1 antibody
    • A1 P145 Activator 1 large subunit antibody
    • Activator 1 140 kDa subunit antibody
    • Activator 1 large subunit antibody
    • Activator 1 subunit 1 antibody
    • DNA binding Protein PO GA antibody
    • DNA-binding protein PO-GA antibody
    • MHC binding factor beta antibody
    • MHCBFB antibody
    • PO GA antibody
    • RECC1 antibody
    • Replication factor C (activator 1) 1, 145kDa antibody
    • Replication factor C 140 kDa subunit antibody
    • Replication factor C antibody
    • Replication factor C large subunit antibody
    • Replication factor C subunit 1 antibody
    • Replication factor C1 antibody
    • RF-C 140 kDa subunit antibody
    • RFC antibody
    • RFC1 antibody
    • RFC1_HUMAN antibody
    • RFC140 antibody
    • RFC140 Replication Factor C 140 kDa subunit antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, methanol permeabilized U2OS cells transfected with Flag-RFC1 labeling RFC1 with ab193559 at 1/2000 dilution (green). Red labeling shows Flag tag detection.

  • All lanes : Anti-RFC1 antibody (ab193559) at 1/2000 dilution

    Lane 1 : U2OS cell lysate
    Lane 2 : NIH3T3 cell lysate
    Lane 3 : INS1 cell lysate
    Lane 4 : DT40 cell lysate

    Lysates/proteins at 40 µg per lane.


    Predicted band size : 128 kDa

    Incubated with ab193559 overnight at 4°C in 5% milk TBST (Tween= 0.5%).

  • All lanes : Anti-RFC1 antibody (ab193559) at 1/2000 dilution

    Lane 1 : Xenopus laevis crude egg extracts
    Lane 2 : U2OS whole cell lysate

    Lysates/proteins at 50 µg per lane.


    Predicted band size : 128 kDa

References

ab193559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up