Overview

  • Product name
  • Description
    Mouse polyclonal to RFXAP
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human RFXAP aa 1-272.
    Sequence:

    MEAQSVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQ PCAGQDEAAAPGGSVGAGKPVRYLCEGAGDGEEEAGEDEADLLDTSDPPG GGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKTCTYEGCSETT SQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLE ESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQK QQQLLNQQVLEQRQQQFPGTSM


    Database link: AAH26088.1

  • Positive control
    • RFXAP transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function
    Part of the RFX complex that binds to the X-box of MHC II promoters.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in RFXAP are a cause of bare lymphocyte syndrome type 2 (BLS2) [MIM:209920]; also known as hereditary MHC class II deficiency or HLA class II-deficient combined immunodeficiency. BLS2 is a severe combined immunodeficiency disease with early onset. It is characterized by a profound defect in constitutive and interferon-gamma induced MHC II expression, absence of cellular and humoral T-cell response to antigen challenge, hypogammaglobulinemia and impaired antibody production. The consequence include extreme susceptibility to viral, bacterial and fungal infections.
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Regulatory factor X associated protein antibody
    • Regulatory factor X-associated protein antibody
    • RFX associated protein antibody
    • RFX DNA binding complex 36 kDa subunit antibody
    • RFX DNA-binding complex 36 kDa subunit antibody
    • RFX-associated protein antibody
    • RFXAP antibody
    • RFXAP_HUMAN antibody
    see all

Images

  • All lanes : Anti-RFXAP antibody (ab172281) at 1 µg/ml

    Lane 1 : RFXAP transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 28 kDa

References

This product has been referenced in:
  • Ding G  et al. IFN-? induces the upregulation of RFXAP via inhibition of miR-212-3p in pancreatic cancer cells: A novel mechanism for IFN-? response. Oncol Lett 15:3760-3765 (2018). Read more (PubMed: 29467893) »
  • Ding G  et al. Pancreatic cancer-derived exosomes transfer miRNAs to dendritic cells and inhibit RFXAP expression via miR-212-3p. Oncotarget 6:29877-88 (2015). IHC . Read more (PubMed: 26337469) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up