Overview

  • Product nameAnti-RGR antibody
    See all RGR primary antibodies
  • Description
    Rabbit polyclonal to RGR
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 76-125 (

    SLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS

    ) of Human RGR, isoform 2 (NP_002912).

  • Positive control
    • PANC-1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceRGR is a putative retinal G-protein coupled receptor and is a member of the opsin subfamily of the 7 transmembrane, G-protein coupled receptor 1 family. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. RGR acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal (the reverse isomerization occurs with rhodopsin in retinal photoreceptor cells). RGR is exclusively expressed in tissue adjacent to retinal photoreceptor cells, the retinal pigment epithelium and Mueller cells. This gene may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Cellular localizationCell Membrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • hRGR antibody
    • Ral GDS related protein antibody
    • Retinal G protein coupled receptor antibody
    • RGR-opsin antibody
    • RP44 antibody
    • RPE retinal G protein coupled receptor antibody
    see all

Anti-RGR antibody images

  • Anti-RGR antibody (ab125371) at 1 µg/ml + PANC-1 cell lysate at 10 µg

    Predicted band size : 32 kDa

References for Anti-RGR antibody (ab125371)

ab125371 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"