Overview

  • Product name
  • Description
    Rabbit polyclonal to RGS13
  • Host species
    Rabbit
  • Specificity
    ab28467 recognises regulator of G-protein signaling 13 (RGS13).
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog
  • Immunogen

    Synthetic peptide within Human RGS13 aa 77-126 (internal sequence). The exact sequence is proprietary.
    Sequence:

    WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK


    Database link: O14921

  • Positive control
    • Daudi cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab28467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 25 kDa (predicted molecular weight: 19 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-RGS13 antibody (ab28467) at 0.5 µg/ml
    Predicted band size: 19 kDa



    RGS13 detected in Daudi cell lysate. Gel concentraton: 12%. An HRP conjugated anti-Rabbit was used as secondary antibody (suggested dilution 1: 50,000 - 100,000).

References

ab28467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab28467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up