Overview

  • Product name
  • Description
    Chicken polyclonal to RGS16
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human RGS16 aa 130-202.
    Sequence:

    VNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRD LAAQASAASA TLSSCSLDEPSHT

  • General notes
    We recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the containers cap.

Properties

Applications

Our Abpromise guarantee covers the use of ab14068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 24 kDa.

Target

  • Function
    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. May play a role in regulating the kinetics of signaling in the phototransduction cascade.
  • Tissue specificity
    Abundantly expressed in retina with lower levels of expression in most other tissues.
  • Sequence similarities
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Palmitoylated on Cys-2 and/or Cys-12.
    Phosphorylation on Tyr-168 upon EGFR stimulation. Enhanced GTPase accelerating (GAP) activity on G(i)-alpha.
  • Information by UniProt
  • Database links
  • Alternative names
    • A28 RGS14 antibody
    • A28 RGS14P antibody
    • A28-RGS14P antibody
    • HGNC:9997 antibody
    • hRGS-r antibody
    • OTTHUMP00000033147 antibody
    • Regulator of G protein signaling 16 antibody
    • Regulator of G protein signalling 16 antibody
    • Regulator of G-protein signaling 16 antibody
    • Retinal-specific RGS antibody
    • Retinally abundant regulator of G protein signaling antibody
    • Retinally abundant regulator of G-protein signaling antibody
    • RGS 16 antibody
    • RGS R antibody
    • RGS-R antibody
    • Rgs14 antibody
    • RGS16 antibody
    • RGS16_HUMAN antibody
    • RGSR antibody
    see all

Images



  • Predicted band size : 24 kDa


    Western blot: E coli-derived fusion protein as test antigen. Affi-anti-RGS16 IgY dilution: 1/2000, Goat anti-IgY-HRP dilution: 1/1000. Colorimetric method for signal development.

References

ab14068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab14068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up