
  • Product name
    Anti-RHBDF1 antibody
  • Description
    Rabbit polyclonal to RHBDF1
  • Host species
  • Tested applications
    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (ALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQP K) of Human RHBDF1 (NP_071895).

  • Positive control
    • 721_B cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab81342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 97 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

IHC-P Use at an assay dependent concentration. PubMed: 24648344


  • Relevance
    RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
  • Cellular localization
    Endoplasmic reticulum and Golgi Apparatus
  • Database links
  • Alternative names
    • C 16 orf 8 antibody
    • C16orf8 antibody
    • chromosome 16 open reading frame 8 antibody
    • Dist 1 antibody
    • Dist1 antibody
    • EGFR RS antibody
    • epidermal growth factor receptor related sequence antibody
    • FLJ 2235 antibody
    • FLJ 22357 antibody
    • FLJ2235 antibody
    • FLJ22357 antibody
    • gene 89 antibody
    • gene 90 antibody
    • h Dist 1 antibody
    • hDist 1 antibody
    • hDist1 antibody
    • RHBDF 1 antibody
    • rhomboid 5 homolog 1 (Drosophila) antibody
    • Rhomboid 5 homolog 1 antibody
    • rhomboid family 1 antibody
    see all


  • Anti-RHBDF1 antibody (ab81342) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 97 kDa

    Gel concentration 12%


This product has been referenced in:
  • Zhou Z  et al. Human rhomboid family-1 suppresses oxygen-independent degradation of hypoxia-inducible factor-1a in breast cancer. Cancer Res 74:2719-30 (2014). IHC-P ; Human . Read more (PubMed: 24648344) »

See 1 Publication for this product

Customer reviews and Q&As

Abcam guarantees this product to work in the species/application used in this Abreview.
Western blot
Loading amount
100000 cells
Gel Running Conditions
Reduced Denaturing
Human Cell lysate - whole cell (squamous cell carcinoma SJG15)
squamous cell carcinoma SJG15
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Abcam user community

Verified customer

Submitted Aug 12 2013


Sign up