Anti-RHBDL2 antibody - N-terminal (ab179726)

Overview

  • Product name
    Anti-RHBDL2 antibody - N-terminal
    See all RHBDL2 primary antibodies
  • Description
    Rabbit polyclonal to RHBDL2 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human RHBDL2 aa 23-72 (N terminal). The exact sequence is proprietary.
    Sequence:

    ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP


    Database link: Q9NX52

  • Positive control
    • 293T whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 2% Sucrose, 98% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Relevance
    RHBDL2, rhomboid like protein 2, is involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. There are 2 named isoforms produced by alternative splicing.
  • Cellular localization
    Membrane; Multi pass membrane protein.
  • Database links
  • Alternative names
    • MGC16997 antibody
    • RHBDL2 antibody
    • Rhomboid like protein 2 antibody
    • Rhomboid related protein 2 antibody
    • Rhomboid veinlet like 2 (Drosophila) antibody
    • RRP2 antibody
    see all

Images

  • Anti-RHBDL2 antibody - N-terminal (ab179726) at 1 µg/ml + 293T whole cell lysate at 10 µg

    Predicted band size : 34 kDa

References

ab179726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up