Overview

  • Product nameAnti-RHBG antibody
    See all RHBG primary antibodies
  • Description
    Rabbit polyclonal to RHBG
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog, Pig, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR

    ) of Human RHBG (NP_065140).

  • Positive control
    • HT1080 lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab102591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-RHBG antibody images

  • Anti-RHBG antibody (ab102591) at 1 µg/ml + HT1080 Cell Lysate at 10 µg

    Predicted band size : 47 kDa

References for Anti-RHBG antibody (ab102591)

ab102591 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"