Overview

  • Product name
    Anti-RHEB antibody [3H6] (HRP)
    See all RHEB primary antibodies
  • Description
    Mouse monoclonal [3H6] to RHEB (HRP)
  • Conjugation
    HRP
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human RHEB aa 1-167.
    Sequence:

    MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVN GQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH GKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSA KENQTAVDVFRRIILEA


    Database link: Q15382

Properties

Applications

Our Abpromise guarantee covers the use of ab187825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 20 kDa.

Target

  • Function
    Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Activates the protein kinase activity of mTORC1. Has low intrinsic GTPase activity.
  • Tissue specificity
    Ubiquitous. Highest levels observed in skeletal and cardiac muscle.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rheb family.
  • Post-translational
    modifications
    Farnesylation is important for efficiently activating mTORC1-mediated signaling.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ras homolog enriched in brain 2, formerly antibody
    • GTP binding protein Rheb antibody
    • GTP-binding protein Rheb antibody
    • MGC111559 antibody
    • Ras homolog enriched in brain 2 antibody
    • Ras homolog enriched in brain antibody
    • RHEB 2 antibody
    • Rheb antibody
    • RHEB_HUMAN antibody
    • RHEB2 antibody
    • RHEB2, formerly antibody
    see all

References

ab187825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up