Overview

  • Product name
  • Description
    Rabbit polyclonal to RHEB
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human RHEB aa 1-184.
    Sequence:

    MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVN GQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH GKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSA KENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM


    Database link: Q15382

  • Positive control
    • Human brain tissue lysate and HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab180838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 20 kDa.

Target

  • Function
    Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Activates the protein kinase activity of mTORC1. Has low intrinsic GTPase activity.
  • Tissue specificity
    Ubiquitous. Highest levels observed in skeletal and cardiac muscle.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rheb family.
  • Post-translational
    modifications
    Farnesylation is important for efficiently activating mTORC1-mediated signaling.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ras homolog enriched in brain 2, formerly antibody
    • GTP binding protein Rheb antibody
    • GTP-binding protein Rheb antibody
    • MGC111559 antibody
    • Ras homolog enriched in brain 2 antibody
    • Ras homolog enriched in brain antibody
    • RHEB 2 antibody
    • Rheb antibody
    • RHEB_HUMAN antibody
    • RHEB2 antibody
    • RHEB2, formerly antibody
    see all

Images

  • All lanes : Anti-RHEB antibody (ab180838) at 1/500 dilution

    Lane 1 : brain cells lysate
    Lane 2 : HeLa cell lysate


    Predicted band size : 20 kDa

References

ab180838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up