Overview

  • Product nameAnti-RHOC antibody
    See all RHOC primary antibodies
  • Description
    Rabbit polyclonal to RHOC
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 36-85 (PTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF S) of Human RHOC, (NP_786886)

  • Positive control
    • human fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab85652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRegulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rho family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Aplysia RAS-related homolog 9 antibody
    • ARH 9 antibody
    • ARH9 antibody
    • ARHC antibody
    • H9 antibody
    • MGC1448 antibody
    • MGC61427 antibody
    • Oncogene RHO H9 antibody
    • Ras homolog gene family member C antibody
    • RAS related homolog 9 antibody
    • RHO C antibody
    • Rho cDNA clone 9 antibody
    • Rho related GTP binding protein RhoC antibody
    • Rho-related GTP-binding protein RhoC antibody
    • rhoC antibody
    • RhoC GTPase antibody
    • RHOC_HUMAN antibody
    • RHOH 9 antibody
    • RHOH9 antibody
    • Small GTP binding protein RhoC antibody
    see all

Anti-RHOC antibody images

  • Sample Type : Brugia malayi intestinal cross section. Primary Antibody Dilution : 1:200. Secondary Antibody : Anti-rabbit-AP. Secondary Antibody Dilution : 1:5000. Gene Name : RHOC.
  • Anti-RHOC antibody (ab85652) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 22 kDa
    Observed band size : 25 kDa (why is the actual band size different from the predicted?)

References for Anti-RHOC antibody (ab85652)

ab85652 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"