Overview

  • Product nameAnti-RHOD antibody
    See all RHOD primary antibodies
  • Description
    Rabbit polyclonal to RHOD
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region between N terminal residues 2 and 51 (TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTV F) of human RHOD (NP_055393).

  • Positive control
    • RHOD transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab80537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/312500.

Target

  • FunctionInvolved in endosome dynamics. May coordinate membrane transport with the function of the cytoskeleton. Participates in reorganization of actin cytoskeleton.
  • Tissue specificityHeart, placenta, liver, skeletal muscle, and pancreas and, with weaker intensity, in several other tissues.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rho family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHD antibody
    • Ras homolog D antibody
    • Ras homolog gene family member A antibody
    • Ras homolog gene family member D antibody
    • Rho antibody
    • RHO D antibody
    • Rho related GTP binding protein RhoD antibody
    • Rho related protein HP1 antibody
    • Rho-related GTP-binding protein RhoD antibody
    • Rho-related protein HP1 antibody
    • RHOD antibody
    • RHOD_HUMAN antibody
    • RhoHP1 antibody
    • RHOM antibody
    see all

Anti-RHOD antibody images

  • Anti-RHOD antibody (ab80537) at 1 µg/ml (in 5% skim milk / PBS buffer) + RHOD transfected 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 23 kDa
    Observed band size : 23 kDa

References for Anti-RHOD antibody (ab80537)

ab80537 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab80537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"