Anti-Rhoptry neck protein 4 antibody (ab193401)

Overview

  • Product name
    Anti-Rhoptry neck protein 4 antibody
  • Description
    Rabbit Polyclonal to Rhoptry neck protein 4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Toxoplasma gondii
  • Immunogen

    Recombinant fragment corresponding to Toxoplasma gondii Rhoptry neck protein 4 aa 2-163.
    Sequence:

    AIKNTLTGSGLLVLLTLACGTTVQSSPPTPAPRMYPNMNERPLSAESRLT PGTYRSELHIDLKSPQKTASQSSLAPTGDNNSKVESIIAGSDTTPRSAEG TSESPPVPQLGTPPRPAPRRSKGEGERQPPTAAPRTSRSVDTGSGSDAST EQQAGGQKVVTP


    Database link: B6KJ32

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 107 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    Toxoplasma gondii infections have the ability to change the behavior of rats and mice, making them drawn to, rather than fearful of, the scent of cats. This effect is advantageous to the parasite, which will be able to sexually reproduce if its host is eaten by a cat. The infection is widespread in the brain, with more cysts targeting the parts of the brain corresponding to fear. The widespread nature of the infection causes many previously unnoticed symptoms in the rats.
  • Cellular localization
    Membrane, Secreted
  • Database links
    • Alternative names
      • Tg65 antibody

    References

    ab193401 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193401.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up