
  • Product name
  • Description
    Rabbit polyclonal to RHOXF1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 130-179 (VPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDC V ) of Human RHOXF1 (NP_644811).

  • Positive control
    • Jurkat cell lysate



Our Abpromise guarantee covers the use of ab108074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Information by UniProt
  • Database links
  • Alternative names
    • homeobox protein, PEPP subfamily, 1 antibody
    • OTEX antibody
    • Ovary, testis and epididymis expressed gene protein antibody
    • Ovary- antibody
    • Paired like homeobox protein OTEX antibody
    • Paired like homeobox protein PEPP 1 antibody
    • Paired-like homeobox protein PEPP-1 antibody
    • PEPP subfamily gene 1 antibody
    • PEPP1 antibody
    • Rhox homeobox family member 1 antibody
    • RHOXF1 antibody
    • RHXF1_HUMAN antibody
    • testis- and epididymis-expressed gene protein antibody
    see all

Anti-RHOXF1 antibody images

  • Anti-RHOXF1 antibody (ab108074) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 21 kDa

References for Anti-RHOXF1 antibody (ab108074)

ab108074 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108074.
Please use the links above to contact us or submit feedback about this product.


Sign up