Anti-RPL26 antibody (ab157111)
Key features and details
- Goat polyclonal to RPL26
- Suitable for: WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-RPL26 antibody
See all RPL26 primary antibodies -
Description
Goat polyclonal to RPL26 -
Host species
Goat -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Turkey, Pig, Xenopus laevis, Chimpanzee, Zebrafish, Rhesus monkey, Gorilla, Xenopus tropicalis, Medaka fish -
Immunogen
Synthetic peptide corresponding to Human RPL26 aa 95-145.
Sequence:VHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQ E
Database link: NP_000978.1 -
Positive control
- WB: HeLa, 293T, Jurkat and NIH/3T3 whole cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab157111 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/1000 - 1/5000. Predicted molecular weight: 17 kDa.
|
Notes |
---|
WB
1/1000 - 1/5000. Predicted molecular weight: 17 kDa. |
Target
-
Sequence similarities
Belongs to the ribosomal protein L24P family. - Information by UniProt
-
Database links
- Entrez Gene: 746392 Chimpanzee
- Entrez Gene: 337890 Cow
- Entrez Gene: 101124083, Gorilla
- Entrez Gene: 6154 Human
- Entrez Gene: 19941 Mouse
- Entrez Gene: 287417 Rat
- Entrez Gene: 406387 Zebrafish
- GenBank: NP_000978.1 Human
see all -
Alternative names
- RPL26L1 antibody
- 60S ribosomal protein L26 antibody
- 60S ribosomal protein L26 like 1 antibody
see all
Images
-
All lanes : Anti-RPL26 antibody (ab157111) at 0.4 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Lane 5 : NIH/3T3 whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 17 kDa
Exposure time: 3 minutes
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab157111 has been referenced in 1 publication.
- von Schalburg KR et al. Subcellular localization and characterization of estrogenic pathway regulators and mediators in Atlantic salmon spermatozoal cells. Histochem Cell Biol N/A:N/A (2017). PubMed: 28983690