Overview

  • Product name
  • Description
    Rabbit polyclonal to RIC8A
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment within Human RIC8A aa 418-468. The exact sequence is proprietary.
    Sequence:

    GLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNP M


    Database link: Q9NPQ8

  • Positive control
    • Whole cell lysate from HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH 3T3 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 60 kDa.

Target

  • Function
    Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins. Able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex (By similarity). Also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.
  • Sequence similarities
    Belongs to the synembryn family.
  • Cellular localization
    Cytoplasm. Cell membrane. Colocalizes with RIC8A in CA2 hippocampal neurons. Colocalizes with GNAI1 and RGS14 at the plasma membrane (By similarity).
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC104517 antibody
    • MGC131931 antibody
    • MGC148073 antibody
    • MGC148074 antibody
    • Protein Ric-8A antibody
    • resistance to inhibitors of cholinesterase 8 homolog A (C. elegans) antibody
    • RIC8 antibody
    • RIC8A antibody
    • RIC8A_HUMAN antibody
    • Synembryn-A antibody
    see all

Images

  • All lanes : Anti-RIC8A antibody (ab194941) at 0.1 µg/ml

    Lane 1 : Whole cell lysate from HeLa
    Lane 2 : Whole cell lysate from 293T
    Lane 3 : Whole cell lysate from Jurkat
    Lane 4 : Whole cell lysate from TCMK-1
    Lane 5 : Whole cell lysate from NIH3T3

    Lysates/proteins at 50 µg per lane.

    Predicted band size: 60 kDa

  • Detection of Human RIC8A by Western Blot of Immunoprecipitate.

    Lane 1: Whole cell lysate from Jurkat cells (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) prepared using NETN lysis buffer. ab194941 was used for IP at 6 μg per reaction, and at 1 μg/ml for blotting the immunoprecipitate.

    Lane 2: Control IgG.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab194941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up