Overview

  • Product name
    Anti-RIC8B antibody
  • Description
    Rabbit polyclonal to RIC8B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RIC8B aa 187-296.
    Sequence:

    QGLPLLTQILESAFSIKWTDEYESAIDHNGPPLSPQETDCAIEALKALFN VTVDSWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLS NVPVSCLDVL


    Database link: BC132689

  • Positive control
    • HeLa and Human fetal brain lysates; Human fetal brain tissue.

Properties

  • Form
    Lyophilised:Add 200 µl of steriled distilled water
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab170006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 59 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.
  • Sequence similarities
    Belongs to the synembryn family.
  • Cellular localization
    Cytoplasm > cell cortex. Localizes to the cell cortex.
  • Information by UniProt
  • Database links
  • Alternative names
    • Brain synembrin antibody
    • brain synembryn antibody
    • hSyn antibody
    • Protein Ric-8B antibody
    • resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) antibody
    • RIC8, C. elegans, homolog of, B antibody
    • Ric8b antibody
    • RIC8B_HUMAN antibody
    • Synembryn, C. elegans, homolog of, B antibody
    • Synembryn-B antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal brain tissue, labeling RIC8B with ab170006 at 1/100 dilution.

  • All lanes : Anti-RIC8B antibody (ab170006) at 1/1000 dilution

    Lane 1 : Human fetal brain lysate
    Lane 2 : HeLa cell lysate

    Predicted band size: 59 kDa

References

ab170006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HEK-293 cells transiently transfected with RIC8B c)
Permeabilization
Yes - 0.2% Triton-X-100
Specification
HEK-293 cells transiently transfected with RIC8B c
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: RT°C
Fixative
Paraformaldehyde
Username

Dr. Elena Tsisanova

Verified customer

Submitted Mar 20 2018

Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Mouse Tissue lysate - whole (mouse right ventricle, left ventricle, right atriu)
Gel Running Conditions
Reduced Denaturing (10)
Loading amount
2000 µg
Specification
mouse right ventricle, left ventricle, right atriu
Blocking step
Milk as blocking agent for 45 minute(s) · Concentration: 5% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted Mar 16 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up