Overview

  • Product nameAnti-RIPK4 antibody
    See all RIPK4 primary antibodies
  • Description
    Rabbit polyclonal to RIPK4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 734-783 (GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSK T) of Human RIPK4 (NP_065690)

  • Positive control
    • 293T cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab84365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 86 kDa (predicted molecular weight: 86 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceRIPK4 (receptor-interacting serine-threonine kinase 4) is a serine/threonine protein kinase which undergoes autophosphorylation. It can activate NFkappaB and is required for keratinocyte differentiation. It interacts with protein kinase C-delta (PRKCD).
  • Cellular localizationCytoplasm. Membrane; Peripheral membrane protein.
  • Database links
  • FormThere are 2 isoforms produced by alternative splicing.
  • Alternative names
    • ANKK 2 antibody
    • ANKK2 antibody
    • ANKRD 3 antibody
    • ANKRD3 antibody
    • Ankyrin repeat domain 3 antibody
    • ankyrin repeat domain containing protein 3 antibody
    • Ankyrin repeat domain protein 3 antibody
    • DIK antibody
    • MGC129992 antibody
    • MGC129993 antibody
    • PKC delta interacting protein kinase antibody
    • PKK antibody
    • protein kinase C-associated kinase antibody
    • Receptor interacting serine threonine kinase 4 antibody
    • Receptor interacting serine/threonine protein kinase 4 antibody
    • RIP 4 antibody
    • RIP4 antibody
    • RIPK 4 antibody
    • Serine/threonine protein kinase ANKRD3 antibody
    see all

Anti-RIPK4 antibody images

  • Anti-RIPK4 antibody (ab84365) at 1 µg/ml + 293T cell lysate at 10 µg

    Secondary
    anti-Rabbit IgG HRP at 1/50000 dilution

    Predicted band size : 86 kDa
    Observed band size : 86 kDa

References for Anti-RIPK4 antibody (ab84365)

ab84365 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"