Overview

  • Product name
    Anti-RLBP1L1 antibody
  • Description
    Rabbit polyclonal to RLBP1L1
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 109-158 (NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDI L) of Human RLBP1L1, NP_775790

  • Positive control
    • Fetal lung lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

Target

  • Relevance
    RLBP1L1 is a protein of unknown function. It has 45% identity with human CRALBP (Cellular retinaldehyde-binding protein) which carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes. RLBP1L1 is expressed in brain, and several human carcinoma cell lines.
  • Cellular localization
    Cytoplasmic
  • Database links
  • Alternative names
    • Cellular retinaldehyde binding protein like antibody
    • CRALBPL antibody
    • FLJ37248 antibody
    • Retinaldehyde binding protein 1 like 1 antibody
    • RLBP1L1 antibody
    see all

Images

  • Anti-RLBP1L1 antibody (ab81315) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 41 kDa
    Observed band size : 41 kDa

References

ab81315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up