Overview

  • Product nameAnti-RLBP1L1 antibody
    See all RLBP1L1 primary antibodies
  • Description
    Rabbit polyclonal to RLBP1L1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 109-158 (NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDI L) of Human RLBP1L1, NP_775790

  • Positive control
    • Fetal lung lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

Target

  • RelevanceRLBP1L1 is a protein of unknown function. It has 45% identity with human CRALBP (Cellular retinaldehyde-binding protein) which carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes. RLBP1L1 is expressed in brain, and several human carcinoma cell lines.
  • Cellular localizationCytoplasmic
  • Database links
  • Alternative names
    • Cellular retinaldehyde binding protein like antibody
    • CRALBPL antibody
    • FLJ37248 antibody
    • Retinaldehyde binding protein 1 like 1 antibody
    • RLBP1L1 antibody
    see all

Anti-RLBP1L1 antibody images

  • Anti-RLBP1L1 antibody (ab81315) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 41 kDa
    Observed band size : 41 kDa

References for Anti-RLBP1L1 antibody (ab81315)

ab81315 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"