Overview

  • Product nameAnti-RMND1 antibody
  • Description
    Rabbit polyclonal to RMND1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 251-300 (LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAI L) of Human RMND1 (NP_060379).

  • Positive control
    • 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRequired for mitochondrial translation, possibly by coordinating the assembly or maintenance of the mitochondrial ribosome (PubMed:23022098, PubMed:25604853).
  • Involvement in diseaseCombined oxidative phosphorylation deficiency 11
  • Sequence similaritiesBelongs to the RMD1/sif2 family.
  • Cellular localizationMitochondrion. May be localized in mitochondrial RNA granules (PubMed:25604853).
  • Information by UniProt
  • Database links
  • Alternative names
    • bA351K16 antibody
    • bA351K16.3 antibody
    • C6orf96 antibody
    • chromosome 6 open reading frame 96 antibody
    • FLJ20627 antibody
    • MGC117362 antibody
    • MGC149570 antibody
    • MGC882602 antibody
    • required for meiotic nuclear division 1 homolog (S. cerevisiae) antibody
    • Required for meiotic nuclear division protein 1 homolog antibody
    • Rmnd1 antibody
    • RMND1_HUMAN antibody
    see all

Anti-RMND1 antibody images

  • Anti-RMND1 antibody (ab98850) at 1 µg/ml + 293T cell lysate at 10 µg

    Predicted band size : 52 kDa

References for Anti-RMND1 antibody (ab98850)

ab98850 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"