Overview

  • Product name
  • Description
    Rabbit polyclonal to RMND5A
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human RMND5A aa 132-181. The exact sequence is proprietary.
    Sequence:

    LDVAEELCQESGLSVDPSQKEPFVELNRILEALKVRVLRPALEWAVSNRE


    Database link: Q9H871

  • Positive control
    • PANC1 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Relevance
    RMND5A contains one CTLH domain and one LisH domain. There are two isoforms.
  • Database links
  • Alternative names
    • C terminal to LisH motif, 44 kDa antibody
    • CTHL antibody
    • GC02P086800 antibody
    • p44CTLH antibody
    • Protein RMD5 homolog A antibody
    • Required for meiotic nuclear division 5 homolog A (S. cerevisiae) antibody
    • RMD5 antibody
    see all

Images

  • Anti-RMND5A antibody (ab186496) at 1 µg/ml + PANC1 cell lysate at 10 µg

    Predicted band size : 43 kDa

References

ab186496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up