
  • Product nameAnti-RNASE9 antibody
    See all RNASE9 primary antibodies
  • Description
    Rabbit polyclonal to RNASE9
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig, Chimpanzee
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 35-84 (PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCN H) of Human RNASE9 (NP_001001673).

  • Positive control
    • Placenta lysate



Our Abpromise guarantee covers the use of ab84689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionDoes not exhibit any ribonuclease activity.
  • Tissue specificityAt the mRNA level, widely expressed (PubMed:18992174). At protein level, restricted to epididymis (PubMed:19137000). Expressed in spermatozoa (sperm head and neck), with higher levels on ejaculated and epididymal sperm than on testicular sperm (at protein level). Expressed in the epithelial cells of the epididymal tubule (at protein level). Not detected in muscle.
  • Sequence similaritiesBelongs to the pancreatic ribonuclease family.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Inactive ribonuclease-like protein 9 antibody
    • ribonuclease 9 antibody
    • ribonuclease like protein 9 antibody
    • ribonuclease RNase A family 9 antibody
    • RNAS9_HUMAN antibody
    • RNASE9 antibody
    see all

Anti-RNASE9 antibody images

  • Anti-RNASE9 antibody (ab84689) at 1 µg/ml + Placenta lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 24 kDa
    Observed band size : 31 kDa (why is the actual band size different from the predicted?)

References for Anti-RNASE9 antibody (ab84689)

ab84689 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84689.
Please use the links above to contact us or submit feedback about this product.