Overview

  • Product name
  • Description
    Mouse polyclonal to RND3
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig, Orangutan
  • Immunogen

    Full length protein corresponding to Human RND3 aa 1-244.
    Sequence:

    MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPE NYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLI CFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELS NHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK TNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVM


    Database link: NP_005159.1

  • Positive control
    • RND3 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa.

Target

Images

  • All lanes : Anti-RND3 antibody (ab171799) at 1 µg/ml

    Lane 1 : RND3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate


    Predicted band size : 27 kDa

References

ab171799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up