Overview

  • Product nameAnti-RNF122 antibody
    See all RNF122 primary antibodies
  • Description
    Rabbit polyclonal to RNF122
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 52-101 (

    SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG

    ) of Mouse RNF122 (NP_780345).

  • Positive control
    • Mouse heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-RNF122 antibody images

  • Anti-RNF122 antibody (ab113810) at 1 µg/ml + mouse heart lysate at 10 µg

    Predicted band size : 17 kDa

References for Anti-RNF122 antibody (ab113810)

ab113810 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"