Overview

  • Product name
  • Description
    Mouse polyclonal to RNF138
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Full length protein corresponding to Human RNF138 aa 1-245. (NP_057355.2).
    Sequence:

    MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRES GAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRH HYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTS SSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDP SQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNI


    Database link: Q8WVD3

  • Positive control
    • RNF138 transfected 293T lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function
    E3 ubiquitin-protein ligase. Together with NLK, involved in the ubiquitination and degradation of TCF/LEF. Also exhibits auto-ubiquitination activity in combination with UBE2K. May act as a negative regulator in the Wnt/beta-catenin-mediated signaling pathway.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Domain
    The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme.
  • Post-translational
    modifications
    Auto-ubiquitinated.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links
  • Alternative names
    • E3 ubiquitin protein ligase RNF138 antibody
    • E3 ubiquitin-protein ligase RNF138 antibody
    • hNARF antibody
    • HSD 4 antibody
    • HSD4 antibody
    • MGC8758 antibody
    • NARF antibody
    • Nemo like kinase associated RING finger protein antibody
    • Nemo-like kinase-associated RING finger protein antibody
    • NLK associated RING finger protein antibody
    • NLK-associated RING finger protein antibody
    • RING finger protein 138 antibody
    • ring finger protein 138, E3 ubiquitin protein ligase antibody
    • RN138_HUMAN antibody
    • Rnf138 antibody
    • STRIN antibody
    see all

Images

  • All lanes : Anti-RNF138 antibody (ab172507) at 1 µg/ml

    Lane 1 : RNF138 transfected 293T lysate
    Lane 2 : Non-transfected lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 28 kDa

References

ab172507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up