Overview

  • Product nameAnti-RNF22 antibody
    See all RNF22 primary antibodies
  • Description
    Rabbit polyclonal to RNF22
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 431-480,

    VKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRG

    , of Human RNF22 (NP_006449).

  • Positive control
    • HepG2 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab102584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 81 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionProbably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation.
  • Tissue specificityExpressed in brain, heart, uterus and testis.
  • Sequence similaritiesBelongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 filamin repeat.
    Contains 6 NHL repeats.
    Contains 1 RING-type zinc finger.
  • DomainThe interaction with MYO5B is dependent upon its NHL repeats, which form a beta-propeller (NHL) domain containing six blades.
  • Cellular localizationCytoplasm. Early endosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • BERP antibody
    • Brain expressed ring finger antibody
    • Brain-expressed RING finger protein antibody
    • FLJ16135 antibody
    • HAC1 antibody
    • RING finger protein 22 antibody
    • RING finger protein 97 antibody
    • RNF22 antibody
    • RNF97 antibody
    • Trim3 antibody
    • TRIM3_HUMAN antibody
    • Tripartite motif containing 3 antibody
    • Tripartite motif protein TRIM3 antibody
    • Tripartite motif-containing protein 3 antibody
    see all

Anti-RNF22 antibody images

  • Anti-RNF22 antibody (ab102584) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 81 kDa

References for Anti-RNF22 antibody (ab102584)

ab102584 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"