Overview

  • Product name
  • Description
    Rabbit polyclonal to RNF31/HOIP
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RNF31/HOIP aa 660-789.
    Sequence:

    ELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHN RMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLL SYFSTLDIQLRESLEPDAYALFHKKLTEGV


    Database link: Q96EP0

  • Positive control
    • Human kidney tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab187976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    E3 ubiquitin-protein ligase component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is proposed to be recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Binds polyubiquitin of different linkage types.
  • Tissue specificity
    Expressed in both normal and transformed breast epithelial cell lines.
  • Sequence similarities
    Contains 2 IBR-type zinc fingers.
    Contains 3 RanBP2-type zinc fingers.
    Contains 1 RING-type zinc finger.
    Contains 1 UBA domain.
  • Domain
    The RanBP2-type zinc fingers mediate the specific interaction with ubiquitin.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • E3 ubiquitin protein ligase RNF31 antibody
    • FLJ10111 antibody
    • FLJ23501 antibody
    • HOIL 1L interacting protein antibody
    • HOIL-1-interacting protein antibody
    • HOIL1L interacting protein antibody
    • HOIP antibody
    • RING finger protein 31 antibody
    • RNF31 antibody
    • RNF31_HUMAN antibody
    • ZIBRA antibody
    • Zinc in between ring finger ubiquitin associated domain antibody
    • Zinc in-between-RING-finger ubiquitin-associated domain protein antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling RNF31/HOIP with ab187976 at 1/50 dilution.

References

ab187976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up