Overview

  • Product nameAnti-RNF39 antibody
    See all RNF39 primary antibodies
  • Description
    Rabbit polyclonal to RNF39
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 178-227

    CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL

    of Human RNF39 (NP_739576).

  • Positive control
    • HepG2 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab104747 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 28 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay play a role in prolonged long term-potentiation (LTP) maintenance.
  • Tissue specificityExpressed in testis.
  • Sequence similaritiesContains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • HZF antibody
    • HZFW antibody
    • HZFW1 antibody
    • LIRF antibody
    • Protein HZFw antibody
    • RING finger protein 39 antibody
    • Rnf39 antibody
    • RNF39_HUMAN antibody
    see all

Anti-RNF39 antibody images

  • Anti-RNF39 antibody (ab104747) at 2.5 µg/ml + HepG2 cell lysate at 10 µg

References for Anti-RNF39 antibody (ab104747)

ab104747 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104747.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"