Overview

  • Product nameAnti-RNF90 antibody
    See all RNF90 primary antibodies
  • Description
    Rabbit polyclonal to RNF90
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 52-101 (

    CIMRCWERPGAGTGTVTRTLPCPLPCPQCREPARPSQLRPNRQLAAVASL

    ) of Rat RNF90 (UniProt: D3ZNJ9).

  • Positive control
    • Rat liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificitySkeletal muscle and placenta, at lower levels in heart, brain and pancreas. Isoform 1 is widely expressed with high level in testis, kidney and heart.
  • Sequence similaritiesBelongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • DomainThe B30.2 domain mediates interaction with GYG. The coiled-coil region mediates homodimerization and heterodimerization.
  • Information by UniProt
  • Database links
  • Alternative names
    • Glycogenin-interacting protein antibody
    • GNIP antibody
    • RING finger protein 90 antibody
    • RNF90 antibody
    • TRIM7 antibody
    • TRIM7_HUMAN antibody
    • Tripartite Motif Containing 7 antibody
    • Tripartite motif protein TRIM 7 antibody
    • Tripartite motif-containing protein 7 antibody
    see all

Anti-RNF90 antibody images

  • Anti-RNF90 antibody (ab125314) at 1 µg/ml + Rat liver lysate at 10 µg

    Predicted band size : 57 kDa

References for Anti-RNF90 antibody (ab125314)

ab125314 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"