Overview

  • Product name
  • Description
    Rabbit polyclonal to RNPC3
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RNPC3 aa 1-68.
    Sequence:

    MAAPEQPLAISRGCTSSSSLSPPRGDRTLLVRHLPAELTAEEKEDLLKYF GAQSVRVLSDKGRLKHTA


    Database link: Q96LT9

  • Positive control
    • HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance
    RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. It participates in pre-mRNA U12-dependent splicing and binds to the 3'-stem-loop of m7G-capped U12 snRNA.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • 2810441O16Rik antibody
    • AI447568 antibody
    • C030014B17Rik antibody
    • FLJ20008 antibody
    • FLJ25070 antibody
    • KIAA183 antibody
    • MGC188204 antibody
    • RBM40 antibody
    • RNA binding motif protein 40 antibody
    • RNA binding protein 40 antibody
    • RNA binding region (RNP1 RRM) containing 3 antibody
    • RNA binding region containing protein 3 antibody
    • RNP antibody
    • SNRNP65 antibody
    • U11/U12 65K antibody
    • U11/U12 small nuclear ribonucleoprotein 65 KDa protein antibody
    • U11/U12 snRNP 65 KDa protein antibody
    • U11/U12 snRNP 65K antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HeLa cells labeling RNPC3 with ab220717 at 4 μg/ml (green).

References

ab220717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up