Overview

  • Product nameAnti-RPA4 antibody
    See all RPA4 primary antibodies
  • Description
    Rabbit polyclonal to RPA4
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Guinea pig, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 215-264 (

    HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

    ) of Human RPA4 (NP_037479)

  • Positive control
    • Human fetal muscle lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/156250.

Target

  • FunctionFunctions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
  • Tissue specificityPreferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels.
  • Cellular localizationNucleus. Localizes to DNA repair foci after DNA damage.
  • Information by UniProt
  • Database links
  • Alternative names
    • HSU24186 antibody
    • MGC120333 antibody
    • MGC120334 antibody
    • p30 antibody
    • Replication factor A protein 4 antibody
    • Replication protein A 30 kDa subunit antibody
    • RF A antibody
    • RF-A protein 4 antibody
    • RFA antibody
    • RFA4_HUMAN antibody
    • RP A antibody
    • RP-A p30 antibody
    • RPA antibody
    • RPA4 antibody
    see all

Anti-RPA4 antibody images

  • Anti-RPA4 antibody (ab81772) at 1 µg/ml + fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa
    Observed band size : 29 kDa

References for Anti-RPA4 antibody (ab81772)

This product has been referenced in:
  • Barkeer S  et al. Molecular mechanism of anticancer effect of Sclerotium rolfsii lectin in HT29 cells involves differential expression of genes associated with multiple signaling pathways: A microarray analysis. Glycobiology 25:1375-91 (2015). Read more (PubMed: 26347523) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab81772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"