Overview

  • Product name
  • Description
    Rabbit polyclonal to RPA4
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Guinea pig, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 215-264 (

    HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

    ) of Human RPA4 (NP_037479)

  • Positive control
    • Human fetal muscle lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/156250.

Target

  • Function
    Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
  • Tissue specificity
    Preferentially expressed in placental and colon mucosa. Widely expressed at intermediate or lower levels.
  • Cellular localization
    Nucleus. Localizes to DNA repair foci after DNA damage.
  • Information by UniProt
  • Database links
  • Alternative names
    • HSU24186 antibody
    • MGC120333 antibody
    • MGC120334 antibody
    • p30 antibody
    • Replication factor A protein 4 antibody
    • Replication protein A 30 kDa subunit antibody
    • RF A antibody
    • RF-A protein 4 antibody
    • RFA antibody
    • RFA4_HUMAN antibody
    • RP A antibody
    • RP-A p30 antibody
    • RPA antibody
    • RPA4 antibody
    see all

Images

  • Anti-RPA4 antibody (ab81772) at 1 µg/ml + fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa
    Observed band size : 29 kDa

References

This product has been referenced in:
  • Barkeer S  et al. Molecular mechanism of anticancer effect of Sclerotium rolfsii lectin in HT29 cells involves differential expression of genes associated with multiple signaling pathways: A microarray analysis. Glycobiology 25:1375-91 (2015). Read more (PubMed: 26347523) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up