
  • Product name
  • Description
    Rabbit polyclonal to RPIA
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 (QRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG T) of Human RPIA, NP_653164

  • Positive control
    • 293T cell lysate



Our Abpromise guarantee covers the use of ab86123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Pathway
    Carbohydrate degradation; pentose phosphate pathway; D-ribose 5-phosphate from D-ribulose 5-phosphate (non-oxidative stage): step 1/1.
  • Involvement in disease
    Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency (RPID) [MIM:608611]. A patient has been described with a deficiency of ribose 5-phosphate isomerase who presented with leukoencephalopathy and peripheral neuropathy. Proton magnetic resonance spectroscopy of the brain revealed a highly elevated level of the polyols ribitol and D-arabitol, which were subsequently also found in high concentrations in body fluids. Deficient activity of RPIA, one of the pentose phosphate pathway enzymes, has been demonstrated in fibroblasts.
  • Sequence similarities
    Belongs to the ribose 5-phosphate isomerase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC antibody
    • MGC103524 antibody
    • Phosphoriboisomerase A antibody
    • Phosphoriboisomerase antibody
    • Ribose 5 phosphate isomerase antibody
    • ribose 5-phosphate epimerase antibody
    • ribose 5-phosphate isomerase A antibody
    • Ribose-5-phosphate isomerase antibody
    • RPI antibody
    • rpiA antibody
    • RPIA_HUMAN antibody
    • zgc:103524 antibody
    see all

Anti-RPIA antibody images

  • Anti-RPIA antibody (ab86123) at 1 µg/ml + 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 33 kDa
    Observed band size : 33 kDa

References for Anti-RPIA antibody (ab86123)

ab86123 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86123.
Please use the links above to contact us or submit feedback about this product.


Sign up